- Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YKL044W (YKL044W)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1017795
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 12,448 Da
- E Coli or Yeast
- 1-106
- Putative uncharacterized protein YKL044W (YKL044W)
Sequence
MGYVIMTFSSARMSERRARIIYIWMHLSAYKINFPFVQFPTFFSLFRLQKKAAILIKNPSPFFLFFLFPYRKNSTARTIHQINQAVALVLLCVSHHLTYLPSVPSL